Intermedin-53 (human) trifluoroacetate salt,CAS: 1140977-96-3
Intermedin-53 (human) trifluoroacetate salt
Product description
Intermedin-53 (human) trifluoroacetate salt,CAS: 1140977-96-3 from ruixi.Intermedin-53 (human) is an important regulatory factor in mean arterial blood pressure and heart rate through its central and peripheral action. It shows cardioprotective effects against myocardial ischemia/reperfusion injury.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 1140977-96-3 |
Sequence | HSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH₂ |
Synonyms | hIMD-53, IMD-53 (human) |
Molecular Formula | C₂₄₇H₃₉₅N₈₃O₇₃S₃ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product